PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P26480_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 281aa    MW: 30929.9 Da    PI: 8.6518
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P26480_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.4e-18133187256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr8P26480_001 133 RKKLRLTKEQSALLEDRFKEHSTLNPKQKHALAKQLNLRPRQVEVWFQNRRARTK 187
                            788899***********************************************98 PP

2HD-ZIP_I/II1253.5e-40133222191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq++lLE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke +eL+
  GSMUA_Achr8P26480_001 133 RKKLRLTKEQSALLEDRFKEHSTLNPKQKHALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTDENRRLQKELQELK 220
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr8P26480_001 221 -AL 222
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-18120183IPR009057Homeodomain-like
SuperFamilySSF466891.09E-18124190IPR009057Homeodomain-like
PROSITE profilePS5007117.184129189IPR001356Homeobox domain
SMARTSM003894.4E-15131193IPR001356Homeobox domain
PfamPF000461.1E-15133187IPR001356Homeobox domain
CDDcd000863.07E-16133190No hitNo description
PROSITE patternPS000270164187IPR017970Homeobox, conserved site
PfamPF021832.0E-11189223IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.5E-25189232IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MSPEIDACDT GLALGLGIGR RSTPSSANSR RLQEACSPLR SSMPQKQPSL TLSLSDDVDG  60
SATLLRAEAN KPSEEGRQAR PSSPHSTVSS FSAAYGPTIK KEKDVTEADE EAEVERVDSR  120
GGTCDDDNDG SARKKLRLTK EQSALLEDRF KEHSTLNPKQ KHALAKQLNL RPRQVEVWFQ  180
NRRARTKLKQ TEVDCEFLKR CCESLTDENR RLQKELQELK ALKFAPSVYM QFPAAGLTMC  240
PSCKTIGAAA DVGPKGGRAE SFVVAPPKPH FFNPFIHSAK C
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1181189RRARTKLKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009415318.10.0PREDICTED: homeobox-leucine zipper protein HOX19-like
SwissprotA2XE762e-78HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL42e-78HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLM0TTV10.0M0TTV1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P26480_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.11e-64HD-ZIP family protein